PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF099600130CFD_t1
Common NameTRAES_3BF099600130CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 387aa    MW: 41658.5 Da    PI: 7.506
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF099600130CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.19e-14307354552
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                              +r rr++kNRe+A rsR+RK+a++ eLe +   L++eN +Lk e +++
  TRAES3BF099600130CFD_t1 307 RRHRRMIKNRESAARSRARKQAYTVELEAELNHLKEENVRLKAEEKTI 354
                              689***************************************887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-11302367IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.668305350IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.2E-13307353No hitNo description
PfamPF001702.9E-11307354IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.25E-10307353No hitNo description
CDDcd147074.95E-23307348No hitNo description
PROSITE patternPS000360310325IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MASEMSKDVK FSEEEVTSHP RVLEGEEQTV VAPARQSSIF ALTLDELQYS VCEAGHNFGS  60
MNMDEFMSNI WNAEEFQAAT GGGLVGMEVA PVVGAGGGGG GGDAGGSNLA RQESFSLPPP  120
LCRKTVEEVW AEINREPRPV HAQPQAARPS QQPPVQPPVV ANDRQGTLGE MTLEQFLVKA  180
GVVRGSGTGV QAPMPVGMVH GQMNPVQQGQ QPGPMMYPMA PANGIFQVMG DDMGFIPNGY  240
AGMAVVPPPP PPQGGVGIVS PGSSDGRSAM TQADMMNCMG DVVMMENGGA RKRGAPKDQS  300
RERSIERRHR RMIKNRESAA RSRARKQAYT VELEAELNHL KEENVRLKAE EKTILLTKKK  360
MLVEQSKENV KAKKGGVLLR RCGSCIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628684.11e-149PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_015628691.11e-149PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLA0A077RNZ10.0A0A077RNZ1_WHEAT; Uncharacterized protein
STRINGMLOC_34679.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.17e-29ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]